Neuromedin B

neuromedin B
Identifiers
Symbol NMB
Entrez 4828
HUGO 7842
OMIM 162340
RefSeq NM_021077
UniProt P08949
Other data
Locus Chr. 15 q11-qter

Neuromedin B (NMB) is a bombesin-related peptide in mammals.[1][2] It was originally purified from pig spinal cord, and later shown to be present in human central nervous system and gastrointestinal tract.[3]

Contents

Sequence

The sequence of the C-terminal decapeptide is highly conserved across mammalian species: GNLWATGHFM-(NH2); this decapeptide is sometimes noted as neuromein B, but it is more accurately described as neuromedin B 23-32. The sequence of neuromedin B (in rat) is : TPFSWDLPEPRSRASKIRVHPRGNLWATGHFM-(NH2).[4]

Function

Figure 1: NMB, 7-TMR receptor and G-protein
Figure 2 : Signal Cascade after NMB binding

Neuromedin regulates the following functions:

  • exocrine and endocrine secretions
  • cell growth
  • body temperature
  • blood pressure and glucose level

Neuromedin signaling pathway

NMB acts by binding to its high affinity cell surface receptor, neuromedin B receptor (NMBR). This receptor is a G protein-coupled receptor with seven transmembrane spanning regions, hence the receptor is also denoted as a 7-transmembrane receptor (7-TMR). Upon binding several intracellular signaling pathways are triggered (see Figure 2).

When NMB binds to its 7-TMR, the heterotrimeric G protein that is attached to the receptor is activated. The G-protein is called heterotrimeric because it consists of 3 polypeptides: α subunit, β subunit, and γ subunit. In the activated NMBR/G-protein complex, there occurs an exchange of GTP for GDP bound to G-α subunit. The G-α subunit, in turn, dissociated form the G-βγ subunits. The free G-α iactivates adenylate cyclase (AC), which, in turn, catalyzes the conversion of ATP to cAMP, the latter of which functioning as a second messenger. cAMP activates of the enzyme Protein Kinase A (PKA). PKA enters the nucleus and activates the cAMP response element-binding protein. The activated CREB binds along with CREB binding protein, co-activator to the CRE region of the DNA in the nucleus. CREB and CBP are held together by leucine zippers. CRE is the control that activates number of growth factors, and thus cell proliferation and some anti-apoptotic genes. In the brain, CREB plays a role in long-term memory and learning.

References

External links


Wikimedia Foundation. 2010.

Look at other dictionaries:

  • Neuromedin U — Identifiers Symbol NMU Entrez 10874 HUGO …   Wikipedia

  • Neuromedin S — Identifiers Symbol NMS Entrez 129521 HUGO …   Wikipedia

  • Neuromedin N — Neuromedin N[1] Identifiers CAS number …   Wikipedia

  • Neuromedin — may refer to: Neuromedin B Neuromedin N Neuromedin U This disambiguation page lists articles associated with the same title. If an internal link led you here, you may wish to c …   Wikipedia

  • neuromedin — noun Any of a family of peptides related to bombesin …   Wiktionary

  • Neuromedin — Neu|ro|me|din [↑ Neur , ↑ Mediator u. ↑ in (3)], das; s, e: Gruppenbez. für Neuropeptide mit versch. Wirkungsorten im Organismus …   Universal-Lexikon

  • Neuromedin U receptor — 1 Identifiers Symbol NMUR1 Alt. symbols GPR66 Entrez 10316 …   Wikipedia

  • Neuromedin U receptor 2 — Identifiers Symbols NMUR2; FM 4; FM4; NMU R2; NMU2R; TGR 1; TGR1 External IDs …   Wikipedia

  • Neuromedin B receptor — Identifiers Symbols NMBR; External IDs OMIM:  …   Wikipedia

  • Neuromedin U receptor 1 — Identifiers Symbols NMUR1; (FM 3); FM 3; FM3; GPC R; GPR66; NMU1R External IDs …   Wikipedia

Share the article and excerpts

Direct link
Do a right-click on the link above
and select “Copy Link”

We are using cookies for the best presentation of our site. Continuing to use this site, you agree with this.